top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|28062394|28090727|-|8|circRNA|KIF18A|NM_031217|12,11,10,9,8,7,6,5

KIF18A

Open Reading Frame (ORF)

LHLQNKDLKAQIRHMMDLACLQEQQHRQTEAPNPQKKFYIYWIMETKTGHNIPLI

Peptide

QTEAPNPQK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page