top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|28035386|28062516|—|4|circRNA|KIF18A|NM_031217|15,14,13,12

KIF18A

Open Reading Frame (ORF)

MPVPSMVPSYMAMTTAAKRKRKLTRNSRKIFIVTICTSRTKI

Peptide

IFIVTICTSRTK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page