top of page

CircRNA

Gene

chr11|230451|233534|—|3|circRNA|SIRT3|NM_001017524|4,3,2

SIRT3

Open Reading Frame (ORF)

LHSLPKTLPRGGHSVLKVEEGPYLFLWVLQVLLEVEAAVTRGSFPCRM

Peptide

TLPRGGHSVLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page