top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|16841546|16855914|-|5|circRNA|PLEKHA7|ENST00000531066.5|9,8,7,6,5

PLEKHA7

Open Reading Frame (ORF)

LGQGHEPGCTGAVSIVTEEAESTYVEARQKPKTVQHGQ

Peptide

LGQGHEPGCTGAVSIVTEEAESTYVEAR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page