top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|16813112|16817322|-|3|circRNA|PLEKHA7|ENST00000531066.5|13,12,11

PLEKHA7

Open Reading Frame (ORF)

LANPCPSQKTTRLFPRAPDTPRGAPRHLPETCQVTTSMRRTEPAT

Peptide

LFPRAPDTPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page