top of page

CircRNA

Gene

chr11|16744600|16752894|+|3|circRNA|C11orf58|ENST00000228136.8|2,3,4

C11orf58

CircRNA UID

circC11orf58(2,3,4)

Open Reading Frame (ORF)

MKNWSLNISKVWTVNYQEDIGDIVDLASVSWDLAIGRQQTWVMKRENKSS

Peptide

VWTVNYQEDIGDIVDLASVSWDLAIGR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page