top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|14457783|14458687|-|2|circRNA|COPB1|ENST00000525214.1|4,3

COPB1

Open Reading Frame (ORF)

LVTVALWQPTFMLVPYLVKMHLQMSALRSQFTRDQMLLLPAI

Peptide

MHLQMSALR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page