top of page

CircRNA

Gene

chr11|13982846|14135568|+|5|circRNA|SPON1|NM_006108|2,3,4,5,6

SPON1

CircRNA UID

circSPON1(2,3,4,5,6)

Open Reading Frame (ORF)

LRSSEDPTPRIMYCGNMEDMPAKASNKLQNWAHP

Peptide

IMYCGNMEDMPAK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page