top of page

CircRNA

Gene

chr11|134184636|134194738|-|6|circRNA|NCAPD3|ENST00000534532.6|19,18,17,16,15,14

NCAPD3

CircRNA UID

circNCAPD3(19,18,17,16,15,14)

Open Reading Frame (ORF)

LNGFQWSLEVISSAVDALQRLCRASAETPAEEQKDVSWQC

Peptide

ASAETPAEEQK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page