top of page

CircRNA

Gene

chr11|133930983|133932213|-|4|circRNA|IGSF9B|ENST00000533871.6|11,10,9,8

IGSF9B

Open Reading Frame (ORF)

MCRHQRGHEHHCQHPPHRHRPSACPQHAPCDLRARGDPWLHPLPCGRRTTGHRGQVEQGRPSPAG

Peptide

HRPSACPQHAPCDLR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page