top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|133911885|133946258|—|18|circRNA|IGSF9B|ENST00000533871.6|19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

IGSF9B

Open Reading Frame (ORF)

MRRDPPSDGTAPTLCRRVVQVRGPHPYLHQVWLLPAARGP

Peptide

GPHPYLHQVWLLPAAR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page