top of page

CircRNA

Gene

chr11|129876720|129892870|—|15|circRNA|NFRKB|ENST00000446488.7|16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

NFRKB

Open Reading Frame (ORF)

MHGFESVVGPVKGVFDKETSLNKAREHSLLRSDRPAYVTILSLEYLWRRNNGFLRPYADRSSGTWSVWRWPWHAHHGGLPPGRHQS

Peptide

RNNGFLRPYADR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page