top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|125997206|126015510|—|6|circRNA|CDON|ENST00000392693.7|12,11,10,9,8,7

CDON

Open Reading Frame (ORF)

LRRSWEPSPQLYLVSQCTAYSSFCTTSNCRKRTENQWGYCGRCWDVSVCSR

Peptide

TENQWGYCGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page