top of page

CircRNA

Gene

chr11|125102637|125111586|-|1|ciRNA|TMEM218|NR_047587|1

TMEM218

CircRNA UID

ciTMEM218(1)

Open Reading Frame (ORF)

MPWCLLPVLSVSRAWGRVDPGEGGRGEESGAAAGKGEKWRVGLRWLEEGVGGRRCTDLADHPYR

Peptide

GEESGAAAGK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page