top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|124975095|124988134|+|4|circRNA|CCDC15|ENST00000529051.5|5,6,7,8

CCDC15

Open Reading Frame (ORF)

MFYSKTTVFSLKTRVFYSNIRTRTSYPETSMFSTKTKIFCQNIRTRIFYLRTRIFYLETSMFSPKTKIFCQNIRTRIFYLRTRIFCLETSMFSPKTRIFYLNIKARIFYLKTRTFYLETSMFSPKTGIFYPNVRTRIFYPETKVFFPKTKIFYPYVRTRIFYPETKVIFLKTKIFYPYVRTGIFYPETCMFSPTTRIFYPNVRTKIFYQNISLVKL

Peptide

IFYLETSMFSPK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page