top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|123729849|123730490|-|1|ciRNA|ZNF202|NM_001301819|1

ZNF202

Open Reading Frame (ORF)

LAGQLGKQAARRAAGGTGGDGKEPWVTGAQAGGGERAVQACASPALSWGG

Peptide

LAGQLGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page