top of page

CircRNA

Gene

chr11|123057847|123058766|-|1|ciRNA|HSPA8|ENST00000453788.6|7

HSPA8

CircRNA UID

ciHSPA8(7)

Open Reading Frame (ORF)

LQPHHHQGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGKEALSSGLDRDNGISIELLVPKGV

Peptide

GKEALSSGLDR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page