top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|122776218|122779695|+|3|circRNA|UBASH3B|ENST00000284273.5|2,3,4

UBASH3B

Open Reading Frame (ORF)

MPWGKPCRPRSVAGNVSSRPRCPWSSIRRPTSSASL

Peptide

SVAGNVSSRPR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page