top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|121604192|121615055|+|9|circRNA|SORL1|ENST00000260197.11|33,34,35,36,37,38,39,40,41

SORL1

Open Reading Frame (ORF)

LHLASRPKPSTRLQWNVPGPAPGMCHTQHLDLHEQGVPVRGRGGLHCALGALRRLPGLLGRER

Peptide

GGLHCALGALR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page