top of page

CircRNA

Gene

chr11|119130724|119133219|+|7|circRNA|HINFP|NM_001243259|3,4,5,6,7,8,9

HINFP

CircRNA UID

circHINFP(3,4,5,6,7,8,9)

Open Reading Frame (ORF)

MLHTGQQPHRAPSQEAPVQVALRASPFSRKNSPACGRNVAFVLWTVLLTSSAMSTSTATTPS

Peptide

NSPACGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page