top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|113804672|113805046|—|2|circRNA|USP28|ENST00000003302.8|21,20

USP28

Open Reading Frame (ORF)

MKNTPGSISLPKRPPPLTVILDFSMSLSTFSKMKHPKG

Peptide

NTPGSISLPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page