top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|108172198|108173851|-|1|circRNA|NPAT|ENST00000278612.8|13

NPAT

Open Reading Frame (ORF)

LLNLYHLSYRHHQGQTVYLLSTKLCHQTFHKMVSLVSPLFVHPIRMMTH

Peptide

LCHQTFHKMVSLVSPLFVHPIR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

14

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page