top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|107428798|107443049|—|5|circRNA|CWF19L2|ENST00000282251.9|8,7,6,5,4

CWF19L2

Open Reading Frame (ORF)

LMGEETRNIQIKSHRKPVLMNTNMFQKTQEKNHKMKS

Peptide

LMGEETR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page