top of page

CircRNA

Gene

chr11|1006617|1008000|+|1|ciRNA|AP2A2|ENST00000332231.9|17

AP2A2

CircRNA UID

ciAP2A2(17)

Open Reading Frame (ORF)

LLFLGFLKFSCPTKHQFLLTVTKIVCVRPRAEAQSENRQVVYNLSDFLKWRSHSGSVRSRQCFEDCLGGRAGPGGVAALDP

Peptide

AGPGGVAALDP

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page