top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|98156092|98209899|+|4|circRNA|R3HCC1L|NM_001256619|2,3,4,5

R3HCC1L

Open Reading Frame (ORF)

MWNSVTSVGMNLMGKHLKTKIWKAELKLIPRFWRYYMSFLEFLVLS

Peptide

MWNSVTSVGMNLMGK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page