top of page

CircRNA

Gene

chr10|96559746|96561977|-|1|ciRNA|TM9SF3|ENST00000371142.8|4

TM9SF3

CircRNA UID

ciTM9SF3(4)

Open Reading Frame (ORF)

LLDRCSLSWIALSVGIIYSCTVRACQSLLATVKLFLLS

Peptide

ACQSLLATVK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page