top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|95375972|95399189|—|6|circRNA|SORBS1|ENST00000371227.8|17,16,15,14,13,12

SORBS1

Open Reading Frame (ORF)

MNLGINSFRNWSLGNRSCLRKKSGRAGLSTNPGKTHLTWQGY

Peptide

NWSLGNRSCLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page