top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|95339132|95410777|—|18|circRNA|SORBS1|ENST00000371227.8|27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10

SORBS1

Open Reading Frame (ORF)

LVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPTGFQSSTK

Peptide

SQCHCKPTGFQSSTK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page