top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|95339132|95346452|—|4|circRNA|SORBS1|ENST00000371227.8|27,26,25,24

SORBS1

Open Reading Frame (ORF)

LVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPTDETCQSQI

Peptide

EDPGDIPTRHLPHHLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page