top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|94724345|94781997|+|6|circRNA|RP11—400G3.5|ENST00000464755.1|5,6,7,8,9,10

RP11-400G3.5

Open Reading Frame (ORF)

LAETGAPVCRTGVTCPTQMLWCTRSRDTLTSSPPTCPMQ

Peptide

SRDTLTSSPPTCPMQ

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page