top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|93408786|93409739|—|2|circRNA|MYOF|NM_013451|7,6

MYOF

Open Reading Frame (ORF)

MGKKMKVMKTGWTMQSGALGPRGQLGRCRKLSLLGGSPK

Peptide

TGWTMQSGALGPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page