top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|93307026|93310019|—|1|ciRNA|MYOF|ENST00000463743.5|33

MYOF

Open Reading Frame (ORF)

LCRRMTRSAAWGCNPSALGKFKVMCLVIRITFSGFHKLRAELFFMI

Peptide

SAAWGCNPSALGK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page