top of page

CircRNA

Gene

chr10|92081319|92091944|—|2|circRNA|CPEB3|ENST00000412050.8|9,8

CPEB3

Open Reading Frame (ORF)

LAAWHSPISRVTLQPSALVLCSFSTMTLTNGCKFDHGT

Peptide

LAAWHSPISR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page