top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|87059149|87062835|—|5|circRNA|GLUD1|NM_005271|10,9,8,7,6

GLUD1

Open Reading Frame (ORF)

LNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLRY

Peptide

YERDSNYHLLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page