top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|80504778|80507204|+|1|ciRNA|TSPAN14|ENST00000429989.7|3

TSPAN14

Open Reading Frame (ORF)

LWKPLSSRMRKSRQQGAGLGDMPPGCPVGQGWAFKHLWASLPSLRRRGEEWRPGSYCREGHGAVAAPGRG

Peptide

EGHGAVAAPGRG

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page