top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|7797046|7802854|+|2|rescued|ATP5F1C|ENST00000356708|105,57|0,5751

ATP5F1C

Open Reading Frame (ORF)

LIEIISGAAALHQETKVHQKHPENYQVYENGSGSKICPS

Peptide

VHQKHPENYQVYENGSGSK

ORF Found in Long-Read

true

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page