top of page

CircRNA

Gene

chr10|77805664|77843706|-|22|circRNA|DLG5|ENST00000372391.6|27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6

DLG5

CircRNA UID

circDLG5(27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6)

Open Reading Frame (ORF)

MDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEGVEAQRVIRDSQQTV

Peptide

DLLALDAFSSDSIPLFEGVEAQRVIR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page