top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|7769215|7780307|—|6|circRNA|KIN|ENST00000379562.8|8,7,6,5,4,3

KIN

Open Reading Frame (ORF)

LGPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEGIPK

Peptide

SALDEIMEGIPK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page