top of page

CircRNA

Gene

chr10|74969659|74985241|+|8|circRNA|KAT6B|ENST00000372725.5|4,5,6,7,8,9,10,11

KAT6B

CircRNA UID

circKAT6B(4,5,6,7,8,9,10,11)

Open Reading Frame (ORF)

MMSSHSFFMSLQKMMKRAVIWLDTSLRTPILFEILS

Peptide

MMSSHSFFMSLQK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page