top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|74129107|74136803|—|4|circRNA|AP3M1|ENST00000355264.8|6,5,4,3

AP3M1

Open Reading Frame (ORF)

LDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQKTTLVSVQRLQLRIMWS

Peptide

TTLVSVQR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page