top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|74074742|74090198|+|5|circRNA|VCL|ENST00000623461.3|8,9,10,11,12

VCL

Open Reading Frame (ORF)

LVCCSLFNDCEPSFQVWGNRDTWVHTFLVGAQDVGSGGNTLSPRSSFPMCDPNVSRASQKAGSQLKKGFCCMTSIGCSVERYVLRDL

Peptide

GFCCMTSIGCSVER

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page