top of page

CircRNA

Gene

chr10|70844472|70871986|+|9|circRNA|SGPL1|NM_003901|3,4,5,6,7,8,9,10,11

SGPL1

Open Reading Frame (ORF)

LSNTKYPFMSTLVWEASSSSLWRKQDTHWSTHLISG

Peptide

YPFMSTLVWEASSSSLWRK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page