top of page

CircRNA

Gene

chr10|69198371|69203043|+|5|circRNA|SUPV3L1|NM_001301683|10,11,12,13,14

SUPV3L1

CircRNA UID

circSUPV3L1(10,11,12,13,14)

Open Reading Frame (ORF)

MFSAQLLSTRSSLLCVLHCYRFETIRGLPPFLCWTMH

Peptide

MFSAQLLSTRSSLLCVLHCYR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page