top of page

CircRNA

Gene

chr10|68786135|68786692|+|2|circRNA|CCAR1|ENST00000630771.2|19,20

CCAR1

Open Reading Frame (ORF)

MITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQIGMRKK

Peptide

DLEEILYTLGLHLSRAQIGMR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page