top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|68394074|68401737|-|4|circRNA|RUFY2|ENST00000466493.5|6,5,4,3

RUFY2

Open Reading Frame (ORF)

MYLKNEEDIGNKESKKIIFELQQNHLGPFGTGGEAVPRSRGNRS

Peptide

IIFELQQNHLGPFGTGGEAVPRSR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page