top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|63192937|63194375|-|3|circRNA|JMJD1C|NM_001282948|15,14,13

JMJD1C

Open Reading Frame (ORF)

MFLITVIKFLCACLSLSSKILLRSLRKMVAAAQRVM

Peptide

MVAAAQR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page