top of page

CircRNA

Gene

chr10|63189167|63189446|-|1|circRNA|JMJD1C|NM_001282948|17

JMJD1C

CircRNA UID

circJMJD1C(17)

Open Reading Frame (ORF)

LQWMKIINYTVIYHILGSVRSIFYGLRIIRIAVIGSFSKNVGNKDRVAKVDGLCLTFLMT

Peptide

IINYTVIYHILGSVRSIFYGLR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page