top of page

CircRNA

Gene

chr10|62198282|62199861|-|2|circRNA|RTKN2|ENST00000315289.6|8,7

RTKN2

CircRNA UID

circRTKN2(8,7)

Open Reading Frame (ORF)

LKRQMGSSLLVSMKNPYHLLGPHSLMVTIKWSSRKRPMEALL

Peptide

NPYHLLGPHSLMVTIK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page