top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|5878096|5888067|—|6|circRNA|ANKRD16|ENST00000380094.9|7,6,5,4,3,2

ANKRD16

Open Reading Frame (ORF)

MDSSDDGLHKEEPGGDPGAGGTWRQSTPEEQRWLEQFPHCQSRRRPSDPPVPAHCLPRCLEDREQN

Peptide

MDSSDDGLHK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page