top of page

CircRNA

Gene

chr10|58216144|58237814|—|3|circRNA|IPMK|ENST00000373935.3|4,3,2

IPMK

Open Reading Frame (ORF)

LEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYCNIQMAQF

Peptide

VYCNIQMAQF

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page